PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 208aa    MW: 24110.9 Da    PI: 9.3099
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.12e-221664250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +ie k   qvtfskRr g++KKA+EL++LC++e+a+i+fs+  k+y + 
  XP_009780250.1 16 KIEMKNHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPARKVYSFV 64
                    68889999**************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.67E-28786IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-32766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.824767IPR002100Transcription factor, MADS-box
CDDcd002652.80E-32876No hitNo description
PRINTSPR004043.6E-18929IPR002100Transcription factor, MADS-box
PfamPF003192.3E-241663IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-182944IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-184465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MAKNPSMGRK KIKIAKIEMK NHLQVTFSKR RSGLFKKASE LCTLCGVEIA IIVFSPARKV  60
YSFVHPNIES IIDKFLSRNP HPIISNRLHF VEGQRYVNVL DLNLKLTQIL VELEVEKKNG  120
ETLNQMRKTR QKQYWWEAPM CELALHELEQ LKDSMEDLNK NVTTHQNSIY SSLIANGVGI  180
FDNYDIKPVM DASNYTNNHI LDYDHGFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-14786181Myocyte-specific enhancer factor 2B
1tqe_Q1e-14786181Myocyte-specific enhancer factor 2B
1tqe_R1e-14786181Myocyte-specific enhancer factor 2B
1tqe_S1e-14786181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780250.11e-156PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_016514293.11e-156PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-55AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLM1DTB51e-91M1DTB5_SOLTU; Uncharacterized protein
TrEMBLM1DUY32e-91M1DUY3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000940623e-91(Solanum tuberosum)
STRINGPGSC0003DMT4000948164e-91(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-57AGAMOUS-like 62